Applied AI Engineer

Tower Hall Parkonsitemid

Posted today · via Workday

About this role

Become a part of our caring community We are seeking Senior AI Software Engineers who thrive on building production-grade, Python-based systems that put generative AI in the hands of real users — not just prototypes or notebooks. The ideal candidate is first and foremost a strong software engineer, with hands-on experience designing, shipping, and operating LLM-powered applications at scale. As a Senior Engineer, you will own the design and delivery of AI-powered services end to end — from API and system design, through implementation and deployment, to monitor and continuous improvement in production.…

Read the full description on 003 Humana's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: flask, fastapi, restful, aws, azure…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Tower Hall Park. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

flaskfastapirestfulawsazuregoogle cloudkubernetesdockerterraformpulumiopentelemetrykafkalangchainllamaindexclaudegitgithub

More at 003 Humana

See all open jobs at 003 Humana