Applied AI Engineer
Tower Hall Parkonsitemid
Posted today · via Workday
About this role
Become a part of our caring community We are seeking Senior AI Software Engineers who thrive on building production-grade, Python-based systems that put generative AI in the hands of real users — not just prototypes or notebooks. The ideal candidate is first and foremost a strong software engineer, with hands-on experience designing, shipping, and operating LLM-powered applications at scale. As a Senior Engineer, you will own the design and delivery of AI-powered services end to end — from API and system design, through implementation and deployment, to monitor and continuous improvement in production.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: flask, fastapi, restful, aws, azure…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Tower Hall Park. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
flaskfastapirestfulawsazuregoogle cloudkubernetesdockerterraformpulumiopentelemetrykafkalangchainllamaindexclaudegitgithub