Software Engineer II, Search & Data Infrastructure -Slack
Washington - Seattleonsitemid$117K – $224K
Posted 3 days ago · via Workday
About this role
To get the best candidate experience, please consider applying for a maximum of 3 roles within 12 months to ensure you are not duplicating efforts. Job Category Software Engineering Job Details About Salesforce Salesforce is the #1 AI CRM, where humans with agents drive customer success together. Here, ambition meets action. Tech meets trust. And innovation isn’t a buzzword — it’s a way of life. The world of work as we know it is changing and we're looking for Trailblazers who are passionate about bettering business and the world through AI, driving innovation, and keeping Salesforce's core values at the heart of it all.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, go, ruby, php…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Washington - Seattle. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavagorubyphpscalasqlmysqlelasticsearchawskubernetesterraformchefsparkhadoopclaudegithubslackteamssalesforce
More at 100 Salesforce
- View →Staff ML Engineer, Fine Tuning - SlackWashington - Seattle
- View →Software Engineer II, Service Network - SlackVirginia - Herndon
- View →Staff Software Engineer, Data Ingestion - SlackVirginia - Washington DC Metro - Remote
- View →Sr. Software Engineer, Cloud Network - SlackVirginia - Washington DC Metro - Remote
- View →Sr. Security Software Engineer, Vulnerability Management - SlackGeorgia - Atlanta
- View →Or Senior Manager, Slack Self Serve Strategy & OperationsCalifornia - San Francisco
