Senior Data Scientist
remotesenior$225K – $250K
via Ashby
About this role
About the Role
Adonis is adding a new Senior Data Scientist to join our growing DS/ML team. You'll work across the modeling lifecycle, from exploratory analysis to production on real claims data, with clear ownership of your work and direct exposure to product and engineering. This role is ideal for someone who executes well independently and is ready to take on larger problem scopes.
Responsibilities
- Build and deploy machine learning models that power our core analytics and intelligence features
- Conduct exploratory data analysis on large-scale claims datasets to identify patterns and anomalies
- Collaborate with engineering to integrate models and data products into production systems
- Monitor model performance and iterate based on results…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, aws, prefect, scikit-learn…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlawsprefectscikit-learnmlflowteams