Senior UI/UX Developer

Nasr Cityonsitesenior

Posted 1w ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

Advansys is seeking a highly skilled Senior UI/UX Designer to join our innovative team. In this role, you will be responsible for leading the design of user-centric digital experiences, collaborating with cross-functional teams to create intuitive and engaging interfaces that enhance customer satisfaction and drive business growth. You will conduct user research, develop wireframes, prototypes, and high-fidelity designs, and ensure consistency across all digital touchpoints. Additionally, you will mentor junior designers and contribute to establishing design best practices within the organization. Requirements 5+ years of professional experience in UI/UX design with a strong portfolio demonstrating your design process and successful projects.…

Read the full description on Advansys's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, html, css, figma, sketch…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Nasr City. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssfigmasketchteams

More at Advansys

See all open jobs at Advansys →