Senior Network & Site Reliability Engineer

senior$210K$240K

via Ashby

About this role

ABOUT US Alembic is the pioneering Causal AI platform. We help the world's largest enterprises move past correlation to prove what actually drives business outcomes — the question marketing and growth teams have never been able to answer with confidence. Fortune 100 companies including Nvidia, Delta Air Lines, and Mars use Alembic to make multimillion-dollar decisions on trusted, causal evidence. We're backed by a $145M Series B from WndrCo (founded by Jeffrey Katzenberg), Jensen Huang, Joe Montana, Prysm Capital, and Accenture. Our models run on our own NVIDIA DGX SuperPOD built on Grace Blackwell infrastructure — one of the fastest private supercomputers in the world. (We've melted GPUs getting here.) ABOUT THE ROLE…

Read the full description on Alembic's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, bash, kubernetes, terraform, ansible…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonbashkubernetesterraformansibledatadoggrafanaprometheusopentelemetryelksparkkafkaairflowteamssoc 2

More at Alembic

See all open jobs at Alembic