reqspace
Start free trial →
A
Amgen

Data Engineer

India - Hyderabadonsitemid

Posted 1mo ago · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Career Category Information Systems Job Description Role Description: Let’s do this. Let’s change the world. We are looking for highly motivated expert Data Engineer who can own the design & development of complex data pipelines, solutions and frameworks. The ideal candidate will be responsible to design, develop, and optimize data pipelines, data integration frameworks, and metadata-driven architectures that enable seamless data access and analytics. This role prefers deep expertise in big data processing, distributed computing, data modeling, and governance frameworks to support self-service analytics, AI-driven insights, and enterprise-wide data management.…

Read the full description on Amgen's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, sql, databricks, aws, jenkins…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in India - Hyderabad. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqldatabricksawsjenkinssparkpysparkgitteamsmaven

More at Amgen

See all open jobs at Amgen →