Principal AI Engineer - Evinova
US - Gaithersburg - MDonsiteprincipal$145K – $190K
Posted today · via Workday
About this role
WHY JOIN US? Evinova is a health-tech business focused on accelerating better health outcomes by advancing digital transformation across the life sciences sector. By combining science-based expertise, evidence-led rigor, and deep human insight, we design digital solutions that enable healthcare to work better for everyone. Operating at the intersection of healthcare, technology, data, and analytics, we are helping unlock the full potential of digital health, transforming how clinical research is conducted, how care is delivered, and how patients experience healthcare. Our solutions are built to scale, driving efficiency, improving decision-making, and ultimately delivering better outcomes for patients worldwide.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, rust, c++, opensearch, aws…
2
Level fit
This role is principal-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in US - Gaithersburg - MD. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonrustc++opensearchawsecsekssagemakerpytorchtensorflowlangchainllamaindexbedrockmodalteams
More at Astrazeneca
- View →RLL-Saphnelo-北京China
- View →MSL Manager-ImmuChina
- View →RD (Hem/ Neph) Medical AdvisorSouth Korea - Seoul
- View →Medical Science Liaison-Biologics-Broad Ashma Combined-NanningChina
- View →(Associate) Country Study Manager - OncoBeijing Yizhuang
- View →Medical Science Liaison-Biologics-Severe Asthma-Changchun/HarbinChina
