Systems & Data Infrastructure Engineer
Bengaluruonsitemid
Posted 1mo ago · via Workable
About this role
Functional Focus: Data Engineering, Real-Time Streaming, and HPC Job Orchestration Scientific Data Architecture: Design crash-safe, binary data formats capable of handling high-speed incremental writes from compute jobs and concurrent reads for query-time calculations. Operational Data Modeling: Design and maintain a relational database schema via an async ORM, backend-agnostic across database engines. HPC Workload Management: Manage the lifecycle of batch and interactivecompute jobs, handling subprocess monitoring, status polling, and cluster filesystem coherency. Real-Time API & Streaming: Build async backend services and long-lived, server-pushed event channels with backpressure handling, and enforce role-based access control on all APIs.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, sql, fastapi, graphql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Bengaluru. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongosqlfastapigraphqlpostgresqlredissqlalchemykafkarabbitmqoauth
More at Astrome Technologies
- View →Customs Handling Agent/SpecialistBengaluru, Karnataka, India
- View →Simulation EngineerBangalore, Karnataka, India
- View →Desktop & 3D Visualization EngineerBengaluru, Karnataka, India
- View →Software Lead Engineer - Space Simulation (Space Domain)Bengaluru, Karnataka, India
- View →Technical WriterBengaluru, India
- View →Assembly Integration and Test Engineer (Space Division)Bengaluru, Karnataka, India
