Systems & Data Infrastructure Engineer

Bengaluruonsitemid

Posted 1mo ago · via Workable

About this role

Functional Focus: Data Engineering, Real-Time Streaming, and HPC Job Orchestration Scientific Data Architecture: Design crash-safe, binary data formats capable of handling high-speed incremental writes from compute jobs and concurrent reads for query-time calculations. Operational Data Modeling: Design and maintain a relational database schema via an async ORM, backend-agnostic across database engines. HPC Workload Management: Manage the lifecycle of batch and interactivecompute jobs, handling subprocess monitoring, status polling, and cluster filesystem coherency. Real-Time API & Streaming: Build async backend services and long-lived, server-pushed event channels with backpressure handling, and enforce role-based access control on all APIs.…

Read the full description on Astrome Technologies's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, go, sql, fastapi, graphql…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Bengaluru. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythongosqlfastapigraphqlpostgresqlredissqlalchemykafkarabbitmqoauth

More at Astrome Technologies

See all open jobs at Astrome Technologies