Principal Data Engineer (PySpark, AI)

Bengaluruonsiteprincipal

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Job Requisition ID # 26WD101628 Position Overview Autodesk is looking for a highly skilled Principal Data Engineer to join our Advanced Compliance Products (ACP) team. ACP is a strategic initiative focused on detecting non-compliant usage of Autodesk software through large-scale data processing and analytics. As a Principal Data Engineer, you will drive the technical architecture, scalability, and modernization of ACP's data engineering platform, leveraging modern cloud technologies and AI-driven engineering practices. You will solve complex engineering challenges, establish best practices, and lead cross-functional technical initiatives while remaining hands-on.…

Read the full description on Autodesk's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, r, sql, snowflake, aws…

Level fit

This role is principal-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Bengaluru. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonrsqlsnowflakeawssparkpysparkhiveairflowpower bigithub

More at Autodesk

See all open jobs at Autodesk →