Senior Software Engineer -Data Platform (Batch Processing & Data Security)
APAC - India - Bengaluru - Sunriveronsitesenior$10K – $17K
Posted yesterday · via Workday
About this role
Job Requisition ID # 26WD96382 Position Overview We are looking for a Senior Software Engineer to join our Data Platform team, focusing on Batch Processing and Data Security/Governance. This role is critical in building scalable,reliable, and secure data pipelines that power enterprise-wide analytics, machine learning, and business decision-making. You will work on designing and operating large-scale data platforms using modern lakehouse architectures, ensuring high data quality, observability, and compliance with security and governance standards Responsibilities Contribute to the team’s vision and articulate strategies to have fundamental impact at our massive scale You will need a product-focused mindset.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, sql, aws…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in APAC - India - Bengaluru - Sunriver. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalasqlawsiamsparkkafkaflinkairflow
More at Autodesk
- View →Enterprise Account Technical LeadParis, FRA
- View →Software Engineer (All Levels) - Forma Design AppsNorway - Oslo
- View →Technical Sales Specialist, D&M IndiaBengaluru, IND
- View →Senior Software Engineer (C++,QT)Pune, IND
- View →Product Support RepresentativeBengaluru, IND
- View →RecruiterBengaluru, IND
