WordPress Developer- Noida

Noidaonsitemid

Posted 15mo ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

SENIOR WORDPRESS DEVELOPER As a Senior WordPress Developer, you will play a key role in the design, development, and maintenance of WordPress-based websites with deep expertise in Advanced Custom Fields Pro (ACF Pro). You will work closely with cross-functional teams including designers, project managers, and other developers to deliver high-quality solutions that meet client needs. You should have a deep understanding of WordPress architecture, strong PHP, HTML, CSS, and JavaScript skills, as well as experience with theme and plugin development, customization, and optimization.…

Read the full description on Azeus Convene's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, php, html, css, sass…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Noida. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcsssassmysqlawsgitteamshotjar

More at Azeus Convene

See all open jobs at Azeus Convene →