B
BetterhelpcomEngineering

Full Stack Software Engineer

US - RemoteRemote (US)mid$110K$160K

via Greenhouse

About this role

Who are we and why should you join us? BetterHelp is on a mission to champion the well-being in all of us and make mental healthcare more accessible to everyone. Founded in 2013, we are now the world’s largest online therapy service, providing affordable and convenient therapy across the globe. Our network of over 30,000 licensed therapists has helped millions of people take ownership of their mental health and change their lives forever. And we’re not stopping there – as the unmet need for mental health services continues to grow, BetterHelp is committed to being part of the solution.…

Read the full description on Betterhelpcom's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, go, php, sql, sass…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptgophpsqlsassreactnext.jsjquerybootstraplaravelmysqlredisgitteams

More at Betterhelpcom

See all open jobs at Betterhelpcom