Senior Engineering Manager (AI Search & Retrieval)
Indiaonsitemanager
via Greenhouse
About this role
Bloomreach is building the world’s premier agentic platform for personalization.We’re revolutionizing how businesses connect with their customers, building and deploying AI agents to personalize the entire customer journey.
We're taking autonomous search mainstream, making product discovery more intuitive and conversational for customers, and more profitable for businesses.
We’re making conversational shopping a reality, connecting every shopper with tailored guidance and product expertise — available on demand, at every touchpoint in their journey.
We're designing the future of autonomous marketing, taking the work out of workflows, and reclaiming the creative, strategic, and customer-first work marketers were always meant to do.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, elasticsearch, aws, gcp…
2
Level fit
This role is manager-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in India. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavaelasticsearchawsgcpsparkkafkaflinkteams
More at Bloomreach
- View →Business Development RepresentativeUnited States
- View →Global Proposal Response Manager, GTM Enablement (AI & Automation)United Kingdom
- View →Machine Learning Customer EngineerUK
- View →Principal HR Business Partner, GTM, AmericasUnited States
- View →Product Manager - Web PersonalizationCzechia
- View →Business ConsultantSlovakia
