Front End Software Engineer

mid$150K$200K

via Ashby

About this role

WHAT YOU’LL BE DOING - You’ll contribute to Candid Health’s product development.  - You’ll ensure there is UX consistency across various pages/components within the Candid app.  - You’ll interact closely with our current and prospective customers, developing intuition around their biggest pain points and thinking of creative ways to address them. - You’ll play a critical role in shaping our engineering and broader company culture and help make this the best place we’ve ever worked. - You’ll ensure we’re using the most relevant front end libraries and tooling.  - You'll have opportunities to build tooling and improvements for front-end dev ops. - You’ll be responsible for front end profiling and monitoring.  WHO YOU ARE…

Read the full description on Candidhealth's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, html, css, react, tailwind…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescripthtmlcssreacttailwindgraphqlfirebase

More at Candidhealth

See all open jobs at Candidhealth