AI/ML Engineer
Chicagoonsitemid$125K – $292K
via Greenhouse
About this role
About the role Chime's Data Science & Machine Learning team builds the models, services, and platforms behind how millions of members manage and grow their financial lives. We're hiring AI/ML Engineers across several teams, Trust & Safety, Lending, Growth, and Foundation Models, and you'll be matched with the team where your background, experience and interests fit best.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, rest, redis, snowflake…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Chicago. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlrestredissnowflakeawssagemakersparkpysparkkafkaairflowpytorchtransformersteams
More at Chime
- View →Senior Litigation ParalegalSan Francisco, CA, USA
- View →Manager, Product SecuritySan Francisco, CA, USA
- View →Senior Associate, Compliance AdvisoryChicago, IL, USA; New York, NY, USA; San Francisco, CA, USA
- View →Software Engineer, Financial PlatformNew York, NY, USA; San Francisco, CA, USA; Seattle, WA, USA
- View →Senior Software Engineer, AI & App ExperienceNew York, NY, USA; San Francisco, CA, USA
- View →Tech Lead Manager, Data Integration PlatformSan Francisco, CA, USA