Staff AI/ML Engineer
San Franciscoonsitemid$246K – $340K
via Greenhouse
About this role
About the role Chime's Data Science & Machine Learning team builds the models, services, and platforms behind how millions of members manage and grow their financial lives. We're hiring a Staff AI/ML Engineer on our Lending and Cashflow team to lead the modeling behind cash flow underwriting and surface member insight: using members' transaction and deposit data to make fair, accurate credit decisions for people that traditional credit scores often miss. In this role, you'll build and deploy machine learning systems on some of the richest transactional and behavioral data in fintech, turning it into the credit decisions behind products like MyPay, Instant Loans, and SpotMe.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, redis, snowflake, aws…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in San Francisco. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlredissnowflakeawssagemakersparkpysparkkafkaairflowpytorchteams
More at Chime
- View →Senior Litigation ParalegalSan Francisco, CA, USA
- View →Manager, Product SecuritySan Francisco, CA, USA
- View →Senior Associate, Compliance AdvisoryChicago, IL, USA; New York, NY, USA; San Francisco, CA, USA
- View →Software Engineer, Financial PlatformNew York, NY, USA; San Francisco, CA, USA; Seattle, WA, USA
- View →Senior Software Engineer, AI & App ExperienceNew York, NY, USA; San Francisco, CA, USA
- View →Tech Lead Manager, Data Integration PlatformSan Francisco, CA, USA