reqspace
Start free trial →
C
CiandtProd_Centaurus+

[Job - 32036] Senior UX/UI Designer, Colombia

Colombiaonsitesenior

Posted 2 days ago · via Lever

See if I'm a fit →Tailor my resume for this role →Apply on Lever ↗

About this role

At CI&T, we help large enterprises transform the potential of AI into real business impact with AI Deployment, AI-native execution, and tech-integrated business solutions. With 30 years of experience in technological transformation, we accelerate innovation with expertise in Agentic SDLC, Application modernization, Data & AI, Martech and Business strategy. We are 8,000 CI&Ters across more than 25 countries, collaborating to build solutions with real impact. AI is already part of how we work, evolve, and innovate every day. At CI&T, we are seeking a highly skilled and motivated Senior UX/UI Designer to join our team in Colombia. You will contribute to an innovative project in a collaborative, transforming, and multicultural environment. Position Overview…

Read the full description on Ciandt's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, html, css, figma, sketch…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Colombia. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssfigmasketchteams

More at Ciandt

See all open jobs at Ciandt →