reqspace
Start free trial →
C
Cisco

Software Engineer

Bangaloreonsitemid

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

What You’ll Do Join our diverse and inclusive Asset and Entitlement Engineering team under Supply Chain IT Organization and be a part of one of the best AI Native Engineering Organization in the world! You'll have the incredible opportunity to join us at Asset and Entitlement Engineering team and play a key role in designing and developing next-generation capabilities. Your role will focus on designing and developing next-generation software to transform Cisco’s Products Lifecycle and Post Sales Customer Experience. As a valued member of our team, you will be responsible for developing and delivering new capabilities using the latest technologies and processes. This includes actively coding, as well as debugging and reviewing with the team.…

Read the full description on Cisco's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, java, sql, less, react…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Bangalore. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavasqllessreactspringspring bootmongodbelasticsearchsnowflakeweaviateelkkafkalangchainllamaindexteams

More at Cisco

See all open jobs at Cisco →