CoderioEngineering

Senior Full-Stack Developer con experiencia en Node.js y React.js – Remoto (LATAM)

Argentinaonsitesenior

Posted 1w ago · via Lever

See if I'm a fit →Tailor my resume for this role →Apply on Lever ↗

About this role

Sobre Coderio Coderio diseña y entrega soluciones digitales escalables para empresas globales. Con una base técnica sólida y una mentalidad orientada al producto, nuestros equipos lideran proyectos de software complejos desde la arquitectura hasta la ejecución. Valoramos la autonomía, la comunicación clara y la excelencia técnica. Colaboramos estrechamente con equipos y socios internacionales, construyendo tecnología que genera impacto. 🌍 Más información: http://coderio.com Qué buscamos Buscamos un Senior Fullstack Developer (Node.js & React.js) para sumarse a nuestro equipo regional en modalidad 100% remota desde LATAM.…

Read the full description on Coderio's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: typescript, sql, css, react, tailwind…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Argentina. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptsqlcssreacttailwindvitenode.jsexpressnestjsrestfulpostgresqlmysqlmongodbdynamodbrdsawss3lambdaekssqssnscloudformationkubernetesdocker

More at Coderio

See all open jobs at Coderio →