Lead Data Scientist
Hyderabadonsitesenior$46K – $420K
via Greenhouse
About this role
Opportunity Overview:
As a Lead Data Scientist at Cohere Health, you will drive high-impact analytics and modeling initiatives that directly inform product development, clinical strategy, and business decision-making. You’ll operate as a senior individual contributor, owning complex problem spaces end-to-end, from framing ambiguous questions to delivering actionable insights and scalable solutions.
You’ll partner closely with Product, Clinical, and Engineering teams to translate real-world healthcare challenges into data-driven strategies, while helping elevate analytical rigor and best practices across the team. This role is ideal for someone who thrives in a fast-paced, mission-driven environment and wants to make a meaningful impact on how care is delivered.
What you’ll do:…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, elasticsearch, aws, emr…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Hyderabad. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlelasticsearchawsemrsparkpysparktransformerscohereteams
More at Coherehealth
- View →Financial AnalystHyderabad, Telangana, India
- View →Manager, Solutions ConfigurationUnited States
- View →Operations Executive AssistantHyderabad, Telangana, India
- View →Manager, Operations and Facility AdministrationHyderabad, Telangana, India
- View →Medical Director Cardiovascular MedicineUnited States
- View →Data AnalystHyderabad, Telangana, India
