reqspace
Start free trial →
C
Commonwealth Bank of Australia

Staff Data Engineer

Sydney CBD Areaonsitestaff

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Staff Data Engineer – Payments Technology Sydney or Melbourne location Shape scalable data platforms and engineering standards across one of CommBank’s most critical technology domains. Build trusted data products and pipelines with AWS, Snowflake, Python and modern distributed data technologies. Influence how Payments data is engineered, operated and made available for reuse across the bank. Do Work That Matters Payments runs and evolves one of CommBank’s most important customer and operational flows, where resilience, safety and disciplined engineering are fundamental. Within Payments and Enterprise Transformation, the focus is also on connecting platforms, data, controls and transformation so change can be delivered with better outcomes for customers.…

Read the full description on Commonwealth Bank of Australia's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, sql, snowflake, redshift, aws…

2

Level fit

This role is staff-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Sydney CBD Area. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqlsnowflakeredshiftawss3lambdaglueemrsagemakersparkpysparkairflowteams

More at Commonwealth Bank of Australia

See all open jobs at Commonwealth Bank of Australia →