C
CoreweaveInformation Technology

Senior Site Reliability Engineer, Data Infrastructure

New Yorkonsitesenior$165K$242K

via Greenhouse

About this role

CoreWeave is The Essential Cloud for AI™. Built for pioneers by pioneers, CoreWeave delivers a platform of technology, tools, and teams that enables innovators to build and scale AI with confidence. Trusted by leading AI labs, startups, and global enterprises, CoreWeave combines superior infrastructure performance with deep technical expertise to accelerate breakthroughs and turn compute into capability. Founded in 2017, CoreWeave became a publicly traded company (Nasdaq: CRWV) in March 2025. Learn more at www.coreweave.com. What You’ll Do: The Platform & Infrastructure Engineering team in the Data Infrastructure organization is responsible for the reliability, scalability, and security of the company’s data platform.…

Read the full description on Coreweave's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: spring, kubernetes, helm, istio, linkerd…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in New York. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

springkuberneteshelmistiolinkerdterraformpulumigithub actionsargo cdgrafanaprometheusopentelemetrysparkkafkaflinkairflowgithubteamssoc 2gdprhipaa

More at Coreweave

See all open jobs at Coreweave