Senior Data Engineer

South Jordanonsitesenior

Posted 5 days ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About Cricut® empowers people to make and personalize almost anything—from custom cards and apparel to everyday items and home décor. Our smart cutting machines, design apps, and materials make creativity easy and accessible for everyone. We believe everyone is born creative, and our mission is to put the power of handmade into the hands of all. With a passionate community of Makers around the world, Cricut helps turn inspiration into real, tangible creations—one project at a time. Let’s make. We're hiring a Senior Data Engineer to shape the data foundation behind Cricut's product analytics, personalization, and AI initiatives. You'll own and evolve our event data platform, from app instrumentation through streaming and batch ingestion to the warehouse.…

Read the full description on Cricut's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, go, sql, dynamodb, redshift…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in South Jordan. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythongosqldynamodbredshiftawss3lambdasqskinesisgluesagemakeriamsparkpysparkkafkaairflowpower biteams

More at Cricut

See all open jobs at Cricut →