Staff AI Product Designer, Growth & Discovery, GeminiApp
Mountain Viewonsitemid
via Greenhouse
About this role
About Us
At Google DeepMind, we aim to unlock state-of-the-art artificial intelligence capabilities across Alphabet, creating positive impact and magical product experiences for billions of users. We're a world-leading AI research company, pushing the boundaries of what's possible with artificial intelligence. Our groundbreaking research spans areas like machine learning, neuroscience, and systems engineering, with applications ranging from scientific discovery to creating more helpful and intuitive products. We're committed to developing AI responsibly and ethically, and we foster a collaborative and inclusive environment where brilliant minds come together to tackle some of the world's most challenging problems. Join us and be part of a team that's shaping the future of AI.
Role…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, gemini, figma…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Mountain View. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssgeminifigmasketchteams
More at Deepmind
- View →Research Scientist, Multimodal Alignment, Safety, and FairnessKirkland, Washington, US; Mountain View, California, US; New York City, New York, US
- View →Research Engineer, Human UnderstandingLos Angeles, California, US; Mountain View, California, US
- View →Research Scientist, Gemini SafetyMountain View, California, US
- View →Research Engineer, Materials ScienceMountain View, California, US
- View →Research Engineer, Multimodal Reasoning For Information LiteracyMountain View, California, US
- View →Distinguished Designer, Gemini App SystemsMountain View, California, US
