D
DhigroupincClearanceJobs Product & Development

Software Engineer - Clearance Jobs

Fieldonsitemid

via Greenhouse

About this role

This Is the Place to Be:​ Connecting Futures Now! DHI Group, Inc. is the parent company of career marketplaces, Dice and ClearanceJobs. We connect candidates with career advice, resources and ultimately a dream job. At DHI, we’ve built a workplace where great people do meaningful work. This is the place to be, and we want you here with us.​ You Belong Here:​ Join a mission-driven company that puts its people first. We’re a collaborative, supportive team that lives by our “One Team” value – working together and winning together. Voted as a certified Great Place to Work®, our team members feel their opinions count and are cared for by DHI. 92% of employees say DHI is a Great Place to Work – 35% higher than the average U.S. company.…

Read the full description on Dhigroupinc's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, php, sql, laravel, graphql…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Field. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptphpsqllaravelgraphqlrestwebsocketmysqlrdsawscloudfronts3ec2lambdadockerterraformclaudemodalgitoauth

More at Dhigroupinc

See all open jobs at Dhigroupinc