Software Engineer, Machine Learning (All Levels / All Teams)
Sunnyvaleonsitemid$137K – $202K
via Greenhouse
About this role
About the Role DoorDash is building the world's most reliable on-demand, logistics engine for delivery. We are continuing to grow rapidly and expanding our Engineering offices globally! We are looking for Software Engineers, Machine Learning to build and maintain a large scale 24x7 global infrastructure system that powers DoorDash's 3-sided marketplace of Consumers, Merchants and Dashers. As a Software Engineer, Machine Learning, you’ll be conceptualizing, designing, implementing, and validating algorithmic improvements to the catalog system and our product knowledge graph at the heart of our fast-growing grocery and retail delivery business.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: go, snowflake, spark, pyspark, scikit-learn…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Sunnyvale. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
gosnowflakesparkpysparkscikit-learnpytorchkerasteams