D
DorsiaEngineering

Platform Engineer, Security

New Yorkonsitemid$100K$160K

via Greenhouse

About this role

About Us Dorsia is at the forefront of hospitality-tech innovation, redefining how the world gains access to the most in-demand restaurants, events, and experiences. By fusing cutting-edge technology with the art of luxury hospitality, we empower our members to secure impossible-to-get reservations while providing operators with unprecedented levels of control, visibility, and revenue optimization. In 2025, we grew revenue 480% and scaled to 400+ venues across 25 destinations, with the launch of our Culture Calendar extending Dorsia beyond restaurants into the world’s most sought-after cultural moments.…

Read the full description on Dorsia's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, php, rails, aws, ecs…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in New York. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptphprailsawsecsfargateiamgithub actionsdatadogsparkgithubteams

More at Dorsia

See all open jobs at Dorsia