Platform Engineer, Security
New Yorkonsitemid$100K – $160K
via Greenhouse
About this role
About Us
Dorsia is at the forefront of hospitality-tech innovation, redefining how the world gains access to the most in-demand restaurants, events, and experiences. By fusing cutting-edge technology with the art of luxury hospitality, we empower our members to secure impossible-to-get reservations while providing operators with unprecedented levels of control, visibility, and revenue optimization.
In 2025, we grew revenue 480% and scaled to 400+ venues across 25 destinations, with the launch of our Culture Calendar extending Dorsia beyond restaurants into the world’s most sought-after cultural moments.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, php, rails, aws, ecs…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in New York. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptphprailsawsecsfargateiamgithub actionsdatadogsparkgithubteams
More at Dorsia
- View →Event ProducerNew York City, New York
- View →Product Manager, Consumer ExperienceNew York City
- View →Platform Engineer, PaymentsNew York, New York
- View →Platform Engineer, AutomationNew York, New York
- View →Junior DesignerMiami, FL or New York City, NY
- View →Vice President of CommunicationsMiami, FL or New York City, NY
