Customer Support Specialist - Alia
Costa Ricaonsitemid
Posted 2mo ago · via Teamtailor
About this role
About Alia Alia is redefining how eCommerce brands turn website visitors into customers. Built exclusively for Shopify, Alia's AI-powered popups combine intelligent targeting, real-time optimisation, and beautifully designed experiences to drive industry-leading opt-in rates and revenue growth. Trusted by thousands of high-growth brands, Alia helps merchants capture high-quality email and SMS subscribers, unlock zero-party data, and deliver more personalised customer journeys from the very first interaction. The Role We work with high-growth ecommerce brands across various platforms, and our support is a huge part of our success.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: html, css, slack, teams, mailchimp…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Costa Rica. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
htmlcssslackteamsmailchimpklaviyo
More at Dot Digital
- View →People Success Advisor (HR Advisor)London, EMEA, GB
- View →Technology Partnerships Manager (US/Canada)New York, Americas, US
- View →Procurement ManagerCape Town, EMEA, ZA
- View →Digital Project ManagerSydney, APAC, AU
- View →Field Marketing ExecutiveLondon, EMEA, GB
- View →Senior Account ExecutiveSydney, APAC, AU