Product Support Engineer - Junior
Cape Townonsitejunior
Posted 4 days ago · via Workable
About this role
Electrum is a next-generation payment software technology company. Since 2012, we've delivered trusted, enterprise-grade, cloud-native software to optimise financial transaction processing. Our deep expertise has established us as a respected partner in high-volume, low-value payment schemes, enabling clients to deliver services to millions of South Africans daily. At Electrum, we are grounded in impact – designing solutions that matter, acting with urgency, and continuously learning as we scale. We believe in creating together – working side by side with our clients and teams to build meaningful, lasting solutions. We prioritise making it safe – encouraging open communication, smart risk-taking, and trust so that creativity and alignment thrive.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, perl, shell, sql…
2
Level fit
This role is junior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Cape Town. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavaperlshellsqlmysqlawssparkteams
More at Electrum Software
- View →Chief Information Security OfficerCape Town, South Africa
- View →Junior React Software EngineerCape Town, Western Cape, South Africa
- View →Client Service ManagerCape Town, Western Cape, South Africa
- View →Product Manager - Value Added ServicesCape Town, Western Cape, South Africa
- View →Software Developer - Team LeadCape Town, Western Cape, South Africa
- View →Software Developer - Java - SeniorCape Town, Western Cape, South Africa
