Technology Engineering Trainee - Entry

IND-Trivandrum-Equifax Analytics-PEConsite

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Equifax is where you can power your possible. If you want to achieve your true potential, chart new paths, develop new skills, collaborate with bright minds, and make a meaningful impact, we want to hear from you. What You’ll Do You will design, develop, test, deploy, maintain and improve software You will translate functional and technical requirements into detailed architecture and design You will need extensive understanding of BDD/TDD practices, code review and analysis techniques, and open source agile testing frameworks.…

Read the full description on Equifax's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, python, java, sql, html…

Level fit

We check your title trajectory against the seniority signal of the role.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in IND-Trivandrum-Equifax Analytics-PEC. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptpythonjavasqlhtmlangularbootstrapmysqlcassandraawsgcpecsdockerterraformchefjenkinssparkhadoopkafkabitbucketjiraconfluence

More at Equifax

See all open jobs at Equifax →