Software Engineer PHP (all genders)
Karlsruhe - STARFACEonsitemid
via Personio
About this role
WEN WIR SUCHEN Programmieren ist deine Leidenschaft und du hast Lust in einem motivierten agilen Scrum-Team an moderne Softwarelösungen zu arbeiten? Du arbeitest eigenverantwortlich, strukturiert, hast Freude an sauberem Code und stellst dich gerne anspruchsvollen technischen Herausforderungen? Für unsere internen Dienste und Prozesse suchen wir jemanden der keine Angst vor legacy Code hat und uns unterstützt den Schritt in eine moderne Architektur zu gehen.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, r, shell, sql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Karlsruhe - STARFACE. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphprshellsqlhtmllaravelsymfonyrestsoappostgresmysqlmariadbdockerjenkinsgit
More at Estos GmbH
- View →Initiativbewerbung Werkstudent (all geneders) / Praktikum / AbschlussarbeitKarlsruhe - STARFACE, DE, München - STARFACE White Label, DE
- View →Quality Engineer - Schwerpunkt Testautomatisierung (all genders)Karlsruhe - STARFACE, DE
- View →Partner Account Manager (all genders) – SüddeutschlandKarlsruhe Gamma Communications Sales, Mobil
- View →Initiativbewerbung FestanstellungKarlsruhe - STARFACE, DE, München - STARFACE White Label, DE
- View →Initiativbewerbung (w/m/d)Starnberg - estos, DE, München - estos, DE
- View →Product Owner PBX (all genders)Karlsruhe - STARFACE, DE