Senior Product Designer – Provider Portals
US - WI - Madisononsitesenior$101K – $172K
Posted 1w ago · via Workday
About this role
Help us change lives At Exact Sciences, we’re helping change how the world prevents, detects and guides treatment for cancer. We give patients and clinicians the clarity needed to make confident decisions when they matter most. Join our team to find a purpose-driven career, an inclusive culture, and robust benefits to support your life while you’re working to help others. Position Overview This position may be site based or remote Exact Science’s Customer & Digital Experience (CDX) team is responsible for defining, driving, and delivering innovative, immersive, memorable customer-centric journeys for all our customers, across all channels (digital and physical).…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, react, figma…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in US - WI - Madison. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssreactfigmasketchmiroteams
More at Exact Sciences
- View →Screening Sales Representative - Topeka, KSUS - KS - Topeka
- View →Screening Sales Representative - Belleville, ILUS - IL - Belleville
- View →Director, Financial Planning & Analysis (PO)US - WI - Madison
- View →Regional Oncology Specialist - Chapel Hill / Greensboro, NCUS - NC - Chapel Hill
- View →Senior SAP Security AnalystUS - WI - Madison
- View →Lead Hereditary Cancer Liaison - Northeast RegionUS - NY - New York City