E
ExigerGovernment: Sales Leadership

Field CTO – Public Sector

McLeanonsitec-level

via Greenhouse

About this role

Who We Are: Exiger transforms supply chains into a strategic advantage—advancing our mission to make the world a safer and more transparent place to succeed. Our AI platform, 1Exiger, delivers instant visibility into complex supplier ecosystems, leveraging proprietary data and advanced AI to surface risk, automate compliance, and unlock efficiencies and cost savings to strengthen long-term resilience. Trusted by 550+ global customers—including Fortune 500 companies and U.S. government agencies—Exiger is a recognized, award-winning leader in supply chain AI and a FedRAMP® authorized provider to the federal government. Field CTO – Public Sector Location: McLean, VA or Richmond, VA Employment Type: Full-Time Role Summary:…

Read the full description on Exiger's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: snowflake, aws, iam, segment, teams…

2

Level fit

This role is c-level-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in McLean. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

snowflakeawsiamsegmentteamsfedramp

More at Exiger

See all open jobs at Exiger