Field CTO – Public Sector
McLeanonsitec-level
via Greenhouse
About this role
Who We Are:
Exiger transforms supply chains into a strategic advantage—advancing our mission to make the world a safer and more transparent place to succeed. Our AI platform, 1Exiger, delivers instant visibility into complex supplier ecosystems, leveraging proprietary data and advanced AI to surface risk, automate compliance, and unlock efficiencies and cost savings to strengthen long-term resilience. Trusted by 550+ global customers—including Fortune 500 companies and U.S. government agencies—Exiger is a recognized, award-winning leader in supply chain AI and a FedRAMP® authorized provider to the federal government.
Field CTO – Public Sector
Location: McLean, VA or Richmond, VA
Employment Type: Full-Time
Role Summary:…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: snowflake, aws, iam, segment, teams…
2
Level fit
This role is c-level-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in McLean. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
snowflakeawsiamsegmentteamsfedramp
More at Exiger
- View →Associate, Research & Delivery (Arabic Speaking)Toronto, Ontario, Canada
- View →Associate, Research & Delivery (English and Chinese language speaking)Toronto, Ontario, Canada
- View →Director, Operations & ImplementationHuntsville, Alabama, United States
- View →Federal Account Executive – Intelligence CommunityRichmond, Virginia, United States
- View →Federal Information System Security Officer (ISSO)McLean, Virginia, United States; Richmond, Virginia, United States
- View →Cyber Supply Chain Risk Management Specialist (C-SCRM)Richmond, Virginia, United States
