AI Engineer III
Austin Domain 11 - HomeAwayonsitemid$146K – $205K
Posted yesterday · via Workday
About this role
At Expedia Group, we help travelers explore the world, one journey at a time. As a global travel company powered by passionate people, trusted partnerships, and leading technology, we connect travelers, partners, and advertisers through our consumer brands, B2B network, and travel advertising business. Here, you'll do meaningful work that helps millions of people discover, book, and experience travel with more ease, confidence, and joy. Our five Behaviors-Traveler First, Think Big, Operate with Excellence, Ownership Mindset, and Succeed Together-help foster a supportive environment where people can grow their careers and have the flexibility, benefits, and support to do their best work. Join us and build for travelers everywhere.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: java, scala, sql, cassandra, spark…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Austin Domain 11 - HomeAway. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascalasqlcassandrasparkkafkaflinkclaudeteams
More at Expedia
- View →DS Analytics II, Advertising Product Analytics & ExperimentationIndia - Bangalore
- View →Senior Software Development Engineer - GenAIUSA - Illinois - Chicago
- View →Senior B2B Creative Project ManagerAustin Domain 11 - HomeAway
- View →Software Development Engineer IIUSA - Illinois - Chicago
- View →Director, Leadership DevelopmentWashington - Seattle Campus
- View →Software Development Engineer IIWashington - Seattle Campus
