Senior Data Engineer, Growth (Remote)
Bostononsitesenior$158K – $190K
via Greenhouse
About this role
ezCater is the #1 food tech platform for workplaces in the US. The company makes it easy for any organization to manage its food needs and order from over 125,000 restaurants nationwide. For workplaces, ezCater provides flexible and scalable solutions for everything from employee meal programs to one-off meetings, all backed by beyond helpful 24/7 service and business-grade reliability. For restaurant partners, ezCater helps grow their business by bringing them new high-value customers and large orders.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, snowflake, redshift, aws…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Boston. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlsnowflakeredshiftawsgcpsagemakerkubernetesdockerairflowdbtfivetranmlflow
More at Ezcaterinc
- View →Senior Manager, People Business Partner (Remote)Boston, MA
- View →Search Associate (Remote)Boston, MA
- View →Account Executive, Meal Programs (Remote)Boston, MA
- View →Internal Communications Lead (Remote)Boston, MA
- View →People Compliance Lead (Remote)Boston, MA
- View →Director, Data & Analytics - Operations (Remote)Remote, US
