Senior Machine Learning Engineer
Atlantaonsitesenior$138K – $182K
via Greenhouse
About this role
THE POSITION
Our roster has an opening with your name on it
At FanDuel, data is the heartbeat of our organization. As a Machine Learning Engineer at FanDuel, you will help us unlock the full potential of our vast amounts of real-time and relational data. You will be asked to provide our business with insight and our customers with world-class personalized experiences. Every click our users make, every bet, every touchdown, every fumble, and every play is fair game for us to turn into a stream of knowledge. Your expertise will be used here to make better and faster decisions – outpacing our competition.
Collaboration is at the core of your role.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, react, flutter, databricks…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Atlanta. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavareactflutterdatabricksawsgcpkinesissagemakerterraformsparkkafkaflinkairflowtableaulookerscikit-learnpytorchtensorflowkerastransformerslangchainmlflowbedrock