reqspace
Start free trial →
F
Fico

Software Engineering – Data Engineer (Python & Cloud Databases)

Work from Homeremotemid$84K – $132K

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

FICO (NYSE: FICO) is a leading global analytics software company, helping businesses in 100+ countries make better decisions. Join our world-class team today and fulfill your career potential! The Opportunity The myFICO engineering team builds the web applications behind FICO Scores consumer-facing business, and data powers everything we do. We are seeking a Data Engineer to own the SQL Server, Amazon Redshift, and other cloud databases behind myFICO.com, build and run the Python ETL/ELT pipelines that feed our data warehouse and analytics platforms, and prepare data for emerging ML and AI use cases in AWS. What You’ll Contribute Design, build, and operate secure, high-performance SQL Server and Redshift databases that power myFICO.com, from data modeling through production support.…

Read the full description on Fico's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, powershell, sql, redshift, rds…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible. We factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonpowershellsqlredshiftrdssqlalchemyawss3lambdagluesagemakerpysparkairflowtableaupandasnumpyscikit-learnclaudegithubteams

More at Fico

See all open jobs at Fico →