Senior Sales Engineer, Enterprise
Remoteremotesenior$21K – $44K
via Greenhouse
About this role
From Fivetran’s founding until now, our mission has remained the same: to make access to data as simple and reliable as electricity. With Fivetran, customer data arrives in their warehouses, canonical and ready to query, with no engineering or maintenance required. We’re proud that more organizations continue to leverage our technology every day to become truly data-driven.
About the Role
Fivetran is building data pipelines to power the modern data stack for thousands of companies.
We’re looking for a talented Senior Sales Engineer to join our Enterprise, Existing Business sales team.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, snowflake, databricks, bigquery…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlsnowflakedatabricksbigqueryawsazuregcpgrafanakafkafivetranteams
More at Fivetran
- View →Customer Support Engineer IIIOakland, California, United States, AMER
- View →Customer Support EngineerDenver, Colorado, United States, AMER
- View →Senior Systems Engineer, R&D Business SystemsToronto, Ontario, Canada
- View →Senior Site Reliability EngineerOakland, California, United States, AMER
- View →Senior Staff Software Engineer - Binary Log Data ReplicationOakland, California, United States, AMER
- View →Legal Operations SpecialistDenver, Colorado, United States, AMER
