Senior Software Engineer - Post-Trade Platform
Amsterdamonsitesenior
via Greenhouse
About this role
Flow Traders is building the next generation of its post-trade platform, covering trade capture, reconciliation, settlement, booking, reporting, and operational workflows across Equities, ETFs, Fixed Income, and Crypto. We are looking for a Senior Software Engineer to take end-to-end ownership of key post-trade domains, helping shape the platform architecture while building reliable, automated, and data-driven services. This role is ideal for an engineer who enjoys solving complex problems, thinking in systems, and building high-quality platforms that deliver real business impact.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, c++, sql, gcp…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Amsterdam. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavac++sqlgcpkubernetesgrafanaprometheusopentelemetrysparkkafkaflinkairflowteams