Senior DevOps Engineer / Site Reliability Engineer
Sydneyonsitesenior
Posted 10mo ago · via Workable
About this role
As a critical and trusted member of the Systems Engineering team, you'll be working side-by-side with software engineers to design and deliver mission critical services and systems. You'll be working with infrastructure and services at scale, utilizing wide variety of cutting edge technologies used to support our high-traffic real-time Freelancer.com marketplace and a range of other business products fully deployed in Amazon Web Services cloud and powered by Nginx, MySQL, Redis, ElasticSearch, RabbitMQ, Consul, Docker, and Kubernetes. It is our mission to build highly resilient, dynamically scaling, self-healing systems by automating and monitoring everything using Terraform, Puppet, Prometheus, Grafana, Kibana, and Jenkins.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, go, ruby, php, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Sydney. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythongorubyphpmysqlrediselasticsearchawsazuregcpecscloudformationkubernetesdockerconsulterraformansiblepuppetchefgrafanaprometheusrabbitmqteams
More at Freelancer
- View →Motion & Visual Designer (AI-Native)Sydney, New South Wales, Australia
- View →Full Stack Software EngineerLondon, England, United Kingdom
- View →Financial ControllerSydney, New South Wales, Australia
- View →Graphic Designer (Motion, Content & Social)Sydney, New South Wales, Australia
- View →Program ManagerVancouver, British Columbia, Canada
- View →Sales Development RepresentativeVancouver, British Columbia, Canada