Engineering Lead - Goodgame Empire
Hamburgonsitesenior
Posted 1mo ago · via Teamtailor
About this role
You'll lead engineering for the Empire Family – Goodgame Empire and Empire: Four Kingdoms , the flagship MMO strategy franchise of Goodgame Studios , a studio with over 200 million registered players and €1B+ in lifetime revenue. Two titles live for over a decade, generating significant revenue, consistently profitable, and a strategic core of Stillfront 's portfolio. Millions of players, always-on worlds, real impact when latency slips by 20 ms. This is not a side project. It's a key franchise you own the engineering for as it moves into its next growth phase. We're looking for a technical leader who ships and owns the whole picture: the architect and reviewer across backend and frontend, who also grows the engineers and the practices around them.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: java, sql, mysql, redis, aws…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Hamburg. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javasqlmysqlredisawssnskinesisk8sdockerterraformkafkaclaude
More at Goodgame Studios
- View →Marketing Developer: Video & Playable AdsRemote, US
- View →Senior Marketing Video ArtistHamburg, Europe, DE
- View →AI Artist - EmpireHamburg, Europe, DE
- View →Senior AI Data & Analytics EngineerHamburg, Europe, DE
- View →Product Lead – Live Strategy Games (m/f/d)Hamburg, Europe, DE
- View →Senior Agentic Engineer - Java Backend & DevOpsHamburg, Europe, DE