Intern, Software Engineer Backend
Petaling Jayaonsitejunior
Posted 2w ago · via Smartrecruiters
About this role
About About Grab and Our Workplace Grab is Southeast Asia's leading superapp. From getting your favourite meals delivered to helping you manage your finances and getting around town hassle-free, we've got your back with everything. In Grab, purpose gives us joy and habits build excellence, while harnessing the power of Technology and AI to deliver the mission of driving Southeast Asia forward by economically empowering everyone, with heart, hunger, honour, and humility. Get to Know the Team The GrabX team, a key component of Grab's Tech Infra, builds and maintains the high-scale, reliable experimentation platform used across all of Grab's marketplaces.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, sql, aws…
2
Level fit
This role is junior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Petaling Jaya. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalasqlawsgcpsparkkafkaflinkgitteams
More at Grab
- View →Manager, HR Strategic Workforce PlanningSingapore, , Singapore
- View →Software Engineer, Mobile (Android)Petaling Jaya, , Malaysia
- View →Senior Systems Engineer (Mobile Device Management)Jakarta, , Indonesia
- View →Senior Software Engineer, Security EngineeringPetaling Jaya, , Malaysia
- View →KAM, Non-Merchant Commercial, Government Assistant ManagerJakarta, , Indonesia
- View →People Operations Business PartnerSingapore, , Singapore
