H
HData Engineering

Staff Data Engineer

New Yorkonsitestaff$170K$190K

Posted 6mo ago · via Lever

About this role

At H1, we believe access to the best healthcare information is a basic human right. Our mission is to provide a platform that can optimally inform every doctor interaction globally. This promotes health equity and builds needed trust in healthcare systems. To accomplish this our teams harness the power of data and AI-technology to unlock groundbreaking medical insights and convert those insights into action that result in optimal patient outcomes and accelerates an equitable and inclusive drug development lifecycle.  Visit h1.co to learn more about us.   Data Engineering is responsible for the development and delivery of our most important asset, our data.…

Read the full description on H's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, sql, aws, kinesis, emr…

2

Level fit

This role is staff-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in New York. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonsqlawskinesisemrcirclecipysparkkafkaairflowclaudegitgithubjirateams

More at H

See all open jobs at H