Design Engineer

mid

via Ashby

About this role

WHY WORK AT HIGGSFIELD AI? Higgsfield AI is the fastest-scaling generative AI company in history, hitting $500M in annual revenue run rate, 25M+ users worldwide, 6M+ generations per day, and powering 390 of Fortune 500 brands. We're building at the absolute frontier of AI-powered video creation and next-generation creative tools. Joining Higgsfield means becoming part of a high-impact team shaping the future of AI-native experiences, at a company that isn't just moving fast, but rewriting what fast looks like. We’re looking for a Design Engineer who loves turning ambitious ideas into polished product experiences. ABOUT THE ROLE This role sits at the intersection of design and engineering.…

Read the full description on Higgsfieldai's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, react, tailwind, figma, teams

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptreacttailwindfigmateams

More at Higgsfieldai

See all open jobs at Higgsfieldai