Designer - Digitalist
Ljubljanaremotemid
Posted 1w ago · via Workable
About this role
The main purpose of the Designer is to work on design-related tasks for Digitalist's assigned clients and projects, with the responsibility to create quality, effective, well-designed, and impactful visual work across websites, e-commerce stores, and paid and owned marketing channels that converts and drives sales for our clients. As a Designer, you will work closely with Account Managers, developers, and specialists to conceptualize and design a variety of client deliverables. On the web side this means design concepts for WordPress and WooCommerce websites and online stores, landing pages, and conversion-focused UX and UI work that is clean to hand over to development.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: html, css, less, express, monday…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
htmlcsslessexpressmondayfigmaslackteamsmailchimpklaviyo
More at Hustler Marketing
- View →Ads Creative Strategist - E-commerce Marketing AgencySofia, Sofia City Province, Bulgaria
- View →Ads Creative Strategist - E-commerce Marketing AgencyRomania
- View →Ads Creative Strategist - E-commerce Marketing AgencyBogotá, Bogota, Colombia
- View →Ads Creative Strategist - E-commerce Marketing AgencyQuito, Pichincha, Ecuador
- View →Ads Creative Strategist - E-commerce Marketing AgencyBulgaria
- View →Ads Creative Strategist - E-commerce Marketing AgencyJohannesburg, Gauteng, South Africa
