reqspace
Start free trial →
H
Hustler MarketingDigitalist

Designer - Digitalist

Sloveniaremotemid

Posted 1w ago · via Workable

See if I'm a fit →Tailor my resume for this role →Apply on Workable ↗

About this role

The main purpose of the Designer is to work on design-related tasks for Digitalist's assigned clients and projects, with the responsibility to create quality, effective, well-designed, and impactful visual work across websites, e-commerce stores, and paid and owned marketing channels that converts and drives sales for our clients. As a Designer, you will work closely with Account Managers, developers, and specialists to conceptualize and design a variety of client deliverables. On the web side this means design concepts for WordPress and WooCommerce websites and online stores, landing pages, and conversion-focused UX and UI work that is clean to hand over to development.…

Read the full description on Hustler Marketing's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: html, css, less, express, monday…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

htmlcsslessexpressmondayfigmaslackteamsmailchimpklaviyo

More at Hustler Marketing

See all open jobs at Hustler Marketing →