I
IhQuality Measurement & Improvement Analyst-Intermediate
Hybrid Careerhybridmid$70K – $80K
Posted 3w ago · via Workday
About this role
FIND YOUR FUTURE We're excited about the potential people bring to our organization. You can grow your career here while enjoying first-class perks, benefits and a culture that fosters growth, innovation and collaboration. Overview The Quality Measurement & Improvement Analyst-Intermediate will integrate data from multiple sources (claims, membership, provider, risk scores, EMR, ADT, etc.) to develop reports and complex analyses to understand and explain quality measure trends and the drivers for the trends with some assistance from the Manager of Quality Measurement & Improvement Analytics or other Senior Quality Measurement & Improvement Analysts.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, r, sql, redshift, aws…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Hybrid Career. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonrsqlredshiftawsathenaemrsagemaker