reqspace
Start free trial →
I
ING Lease Belgium

Senior Java Developer

PB_Cen_Warszawa (ul. Puławska 2)onsitesenior

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Forma zatrudnienia: umowa o pracę Lokalizacja : ul. Sokolska 34, Katowice lub ul. Puławska 2, Warszawa (2 dni w tygodniu pracujemy z biura) Wynagrodzenie: 16 000 - 20 000 zł brutto O zespole: Dołącz do zespołu odpowiedzialnego za rozwój autorskich aplikacji wspierających komunikację z klientami biznesowymi ING. Tworzymy rozwiązania, które odpowiadają za prezentowanie spersonalizowanych komunikatów w bankowości internetowej i mobilnej, wspierając działania marketingowe oraz procesy sprzedażowe. Pracujemy nad rozwojem kluczowych aplikacji o rozbudowanej logice biznesowej, realizując strategiczne inicjatywy związane z transformacją architektury i budowaniem nowoczesnych rozwiązań odpowiadających na potrzeby klientów w czasie rzeczywistym.…

Read the full description on ING Lease Belgium's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: java, sql, spring, spring boot, restful…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in PB_Cen_Warszawa (ul. Puławska 2). We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javasqlspringspring bootrestfulrediskubernetesdockergrafanaprometheusopentelemetryelksparkkafkaairflow

More at ING Lease Belgium

See all open jobs at ING Lease Belgium →