Cloud Engineer
Jakartaonsitemid
Posted 1mo ago · via Workday
About this role
Why choose iZeno? iZeno was founded in 2003 to provide enterprises with custom-built technology solutions they need to keep their business running seamlessly. Logicalis Asia, part of the Logicalis Group, a leading international IT solutions and managed services provider, has acquired a majority stake in iZeno , a company specialising in digital transformation, application modernisation, DevOps, customer experience and hybrid cloud solutions. With a team of 120+ in-house innovators, we have delivered over 500 Enterprise Solutions, implemented, and optimized to enable smarter insights.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: shell, bash, postgresql, cassandra, aws…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Jakarta. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
shellbashpostgresqlcassandraawsgcpgrafanakafka
More at iZeno Thailand
- View →Senior Cloud EngineerKuala Lumpur, MY (iZeno)
- View →Enterprise Account ManagerBangkok, TH (iZeno)
- View →Enterprise Account Manager (Strategic Account)351 on Braddell, SG (iZeno)
- View →Project Manager351 on Braddell, SG (iZeno)
- View →Senior Cloud EngineerJakarta, ID (iZeno)
- View →Data EngineerKuala Lumpur, MY (iZeno)
