J
JuaMember of the technical staff (Frontend Engineer)
remotemid$140K – $179K
via Ashby
About this role
OVERVIEW
Physical AI, a real model of the world, is the next trillion dollar opportunity and a foundational pillar for energy, robotics and superintelligence.
At Jua we are building it now. Our models already run on four continents and help power the energy buildout needed to support ever larger intelligence.
We are assembling a world-class team of researchers and entrepreneurial minds to turn this model into reality at global scale. If you want the opportunity of your life, come build physical AI with us.
WHAT WE’RE LOOKING FOR
We’re hiring a front-end–leaning full-stack engineer to help define and build the future of our platform.
You should have a strong sense of design, deep empathy for users, and a general grasp of machine learning or the latest AI technologies.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, python, rust, sql, react…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptpythonrustsqlreacttailwindfastapigrpcclickhousefigma
